C-Type Lectin Domain Family 4, Member M (CLEC4M) (Middle Region) Antikörper

Produktnummer ABIN634663

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch C-Type Lectin Domain Family 4, Member M in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für C-Type Lectin Domain Family 4, Member M (CLEC4M) (Middle Region) Antikörper (ABIN634663)

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: Middle Region

Spezifität: CLEC4 M antibody was raised against the middle region of CLEC4

Aufreinigung: Affinity purified

Immunogen: CLEC4 M antibody was raised using the middle region of CLEC4 corresponding to a region with amino acids NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLEC4M Blocking Peptide, (ABIN5612925), is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Andere Bezeichnung: CLEC4M

Hintergrund: CLEC4M is a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. It is involved in the innate immune system and recognises numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health.

Molekulargewicht: 45 kDa (MW of target protein)