In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Hemochromatosis (HFE) Antikörper

Antigen

Hemochromatosis (HFE)

Synonyme HH, HFE1, HLA-H, MVCD7, MGC103790, dJ221C16.10.1
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Immunhistochemie (IHC), Western Blot (WB)
Produktnummer ABIN634557
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung HFE
Immunogen HFE antibody was raised using the C terminal of HFE corresponding to a region with amino acids FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
Beschreibung HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.
Molekulargewicht 28 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HFE antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Stammzellen, Hämopoetische Vorläufer, Metabolismus

Alternativen

Alternativen zu Antigen "Hemochromatosis (HFE)", Typ "Antikörper" finden
Wirte Kaninchen (10), Maus (5)
Reaktivitäten Human (15), Rind (Kuh) (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (14), Enzyme Immunoassay (EIA) (4), ELISA (3), Durchflusszytometrie (FACS) (3), Immunhistochemie (IHC) (3), ELISA (Detektionsantikörper) (2), Immunfluoreszenz (IF) (2), Dot Blot (Dot) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1)
Epitope N-Term (3), Center (2)