HLA-DPA1 Antikörper (Middle Region)

Produktnummer ABIN634553

Der Kaninchen Polyklonal anti-HLA-DPA1 Antikörper wird verwendet zum Nachweis von HLA-DPA1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für HLA-DPA1 Antikörper (Middle Region) (ABIN634553)

Target: HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HLA-DPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HLA-DPA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HLA-DPA1 antibody was raised against the middle region of HLA-DPA1

Aufreinigung: Affinity purified

Immunogen: HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HLA-DPA1 Blocking Peptide, (ABIN937661), is also available for use as a blocking control in assays to test for specificity of this HLA-DPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HLA-DPA1

Target: HLA-DPA1 (Major Histocompatibility Complex, Class II, DP alpha 1 (HLA-DPA1))

Andere Bezeichnung: HLA-DPA1

Hintergrund: HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins.

Molekulargewicht: 26 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, Cancer Immune Checkpoints, Human Leukocyte Antigen (HLA) in Adaptive Immune Response