Selenoprotein S Antikörper (Middle Region)

Produktnummer ABIN634546

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Selenoprotein S in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Selenoprotein S Antikörper (Middle Region) (ABIN634546)

Target: Selenoprotein S (SELS)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Selenoprotein S Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Selenoprotein S Antikörper

Bindungsspezifität: Middle Region

Spezifität: SELS antibody was raised against the middle region of SELS

Aufreinigung: Affinity purified

Immunogen: SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SELS Blocking Peptide, (ABIN5616036), is also available for use as a blocking control in assays to test for specificity of this SELS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Selenoprotein S

Target: Selenoprotein S (SELS)

Andere Bezeichnung: SELS

Hintergrund: SELS is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Cell RedoxHomeostasis, Negative Regulation of intrinsic apoptotic Signaling, SARS-CoV-2 Protein Interaktom