RAB11B Antikörper (C-Term)

Produktnummer ABIN634441

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RAB11B in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für RAB11B Antikörper (C-Term) (ABIN634441)

Target: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB11B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAB11B Antikörper

Bindungsspezifität: C-Term

Spezifität: RAB11 B antibody was raised against the C terminal of RAB11

Aufreinigung: Affinity purified

Immunogen: RAB11 B antibody was raised using the C terminal of RAB11 corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB11B Blocking Peptide, (ABIN939339), is also available for use as a blocking control in assays to test for specificity of this RAB11B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB11B

Target: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Andere Bezeichnung: RAB11B

Hintergrund: RAB11B possesses GTPase activity.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis