ADA Antikörper (Middle Region)

Produktnummer ABIN634318

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ADA in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für ADA Antikörper (Middle Region) (ABIN634318)

Target: ADA (Adenosine Deaminase (ADA))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADA Antikörper

Bindungsspezifität: Middle Region

Spezifität: ADA antibody was raised against the middle region of ADA

Aufreinigung: Affinity purified

Immunogen: ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADA Blocking Peptide, (ABIN936798), is also available for use as a blocking control in assays to test for specificity of this ADA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADA

Target: ADA (Adenosine Deaminase (ADA))

Andere Bezeichnung: ADA

Hintergrund: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process