POLL Antikörper

Produktnummer ABIN634210

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch POLL in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für POLL Antikörper (ABIN634210)

Target: POLL (Polymerase (DNA Directed), lambda (POLL))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POLL Antikörper

Aufreinigung: Affinity purified

Immunogen: POLL antibody was raised using a synthetic peptide corresponding to a region with amino acids SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLL Blocking Peptide, (ABIN5615458), is also available for use as a blocking control in assays to test for specificity of this POLL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLL

Target: POLL (Polymerase (DNA Directed), lambda (POLL))

Andere Bezeichnung: POLL

Hintergrund: POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: DNA Reparatur, Production of Molecular Mediator of Immune Response