X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1) Antikörper

Antigen: X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC1)

Synonyme: DKFZp781P0919, RecA, RAD51, 4921524O04Rik, 8030409M04Rik, XRCC2, RGD1564823, MGC160004

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN634115

Produktbeschreibung

Weitere Bezeichnung: XRCC2

Immunogen: XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA

Beschreibung: XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.

Molekulargewicht: 31 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRCC2 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Chromatin und nukleäre Signaltransduktion, DNS/RNS