KPNA2 Antikörper

Produktnummer ABIN634070

Der Kaninchen Polyklonal anti-KPNA2 Antikörper wird verwendet zum Nachweis von KPNA2 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für KPNA2 Antikörper (ABIN634070)

Target: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KPNA2 Antikörper

Aufreinigung: Affinity purified

Immunogen: Karyopherin Alpha 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Karyopherin Alpha 2 Blocking Peptide, (ABIN938988), is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPNA2

Target: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Andere Bezeichnung: Karyopherin alpha 2

Hintergrund: Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus