PCSK1 Antikörper (Middle Region)

Produktnummer ABIN633993

Der Kaninchen Polyklonal anti-PCSK1 Antikörper (ABIN633993) detektiert spezifisch PCSK1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PCSK1 Antikörper (Middle Region) (ABIN633993)

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCSK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCSK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PCSK1 antibody was raised against the middle region of PCSK1

Aufreinigung: Affinity purified

Immunogen: PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCSK1 Blocking Peptide, (ABIN5615263), is also available for use as a blocking control in assays to test for specificity of this PCSK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCSK1

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Andere Bezeichnung: PCSK1

Hintergrund: PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.

Molekulargewicht: 71 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism