SERPIND1 Antikörper

Produktnummer ABIN633840

Der Kaninchen Polyklonal anti-SERPIND1 Antikörper (ABIN633840) detektiert spezifisch SERPIND1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Ratte und Maus.

Kurzübersicht für SERPIND1 Antikörper (ABIN633840)

Target: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SERPIND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SERPIND1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPIND1 Blocking Peptide, (ABIN5616070), is also available for use as a blocking control in assays to test for specificity of this SERPIND1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPIND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SERPIND1

Target: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Andere Bezeichnung: SERPIND1

Hintergrund: The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns.

Molekulargewicht: 55 kDa (MW of target protein)