Neuroserpin Antikörper

Produktnummer ABIN633836

Der Kaninchen Polyklonal anti-Neuroserpin Antikörper wird verwendet zum Nachweis von Neuroserpin in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Neuroserpin Antikörper (ABIN633836)

Target: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Neuroserpin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Neuroserpin Antikörper

Aufreinigung: Affinity purified

Immunogen: SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINI1 Blocking Peptide, (ABIN936726), is also available for use as a blocking control in assays to test for specificity of this SERPINI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Neuroserpin

Target: Neuroserpin (SERPINI1) (serpin Peptidase Inhibitor, Clade I (neuroserpin), Member 1 (SERPINI1))

Andere Bezeichnung: SERPINI1

Hintergrund: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Regulation of Hormone Metabolic Process