PHYH Antikörper (Middle Region)

Produktnummer ABIN633832

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PHYH in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für PHYH Antikörper (Middle Region) (ABIN633832)

Target: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHYH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PHYH Antikörper

Bindungsspezifität: Middle Region

Spezifität: PHYH antibody was raised against the middle region of PHYH

Aufreinigung: Affinity purified

Immunogen: PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHYH Blocking Peptide, (ABIN937889), is also available for use as a blocking control in assays to test for specificity of this PHYH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHYH

Target: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Andere Bezeichnung: PHYH

Hintergrund: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process