SCN3B Antikörper (N-Term)

Produktnummer ABIN633798

Der Kaninchen Polyklonal anti-SCN3B Antikörper (ABIN633798) detektiert spezifisch SCN3B in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Ratte, Human und Maus.

Kurzübersicht für SCN3B Antikörper (N-Term) (ABIN633798)

Target: SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))

Reaktivität: Ratte, Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCN3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCN3B Antikörper

Bindungsspezifität: N-Term

Spezifität: SCN3 B antibody was raised against the N terminal of SCN3

Aufreinigung: Affinity purified

Immunogen: SCN3 B antibody was raised using the N terminal of SCN3 corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCN3B Blocking Peptide, (ABIN5616014), is also available for use as a blocking control in assays to test for specificity of this SCN3B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCN3B

Target: SCN3B (Sodium Channel, Voltage-Gated, Type III, beta Subunit (SCN3B))

Andere Bezeichnung: SCN3B

Hintergrund: SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.

Molekulargewicht: 24 kDa (MW of target protein)