SCN1B Antikörper (Middle Region)

Produktnummer ABIN633779

Der Kaninchen Polyklonal anti-SCN1B Antikörper wird verwendet zum Nachweis von SCN1B in Proben von Human und Hund. Er wurde validiert für WB.

Kurzübersicht für SCN1B Antikörper (Middle Region) (ABIN633779)

Target: SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SCN1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SCN1B Antikörper

Bindungsspezifität: Middle Region

Spezifität: SCN1 B antibody was raised against the middle region of SCN1

Aufreinigung: Affinity purified

Immunogen: SCN1 B antibody was raised using the middle region of SCN1 corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SCN1B Blocking Peptide, (ABIN5616013), is also available for use as a blocking control in assays to test for specificity of this SCN1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SCN1B

Target: SCN1B (Sodium Channel, Voltage-Gated, Type I, beta (SCN1B))

Andere Bezeichnung: SCN1B

Hintergrund: Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.

Molekulargewicht: 25 kDa (MW of target protein)