TRPC6 Antikörper (N-Term)

Produktnummer ABIN633748

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TRPC6 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für TRPC6 Antikörper (N-Term) (ABIN633748)

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRPC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TRPC6 Antikörper

Bindungsspezifität: N-Term

Spezifität: TRPC6 antibody was raised against the N terminal of TRPC6

Aufreinigung: Affinity purified

Immunogen: TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRPC6 Blocking Peptide, (ABIN5616812), is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPC6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRPC6

Target: TRPC6 (Transient Receptor Potential Cation Channel, Subfamily C, Member 6 (TRPC6))

Andere Bezeichnung: TRPC6

Hintergrund: TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Molekulargewicht: 106 kDa (MW of target protein)