DDX17 Antikörper

Produktnummer ABIN633599

Der Kaninchen Polyklonal anti-DDX17 Antikörper wird verwendet zum Nachweis von DDX17 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für DDX17 Antikörper (ABIN633599)

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX17 Antikörper

Aufreinigung: Affinity purified

Immunogen: DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX17 Blocking Peptide, (ABIN5613155), is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX17 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX17

Target: DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))

Andere Bezeichnung: DDX17

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The DEAD box protein is an ATPase activated by a variety of RNA species but not by dsDNA. This protein and that encoded by DDX5 gene are more closely related to each other than to any other member of the DEAD box family.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Muscle Cell Differentiation