STAU1/Staufen Antikörper

Produktnummer ABIN633486

Der Kaninchen Polyklonal anti-STAU1/Staufen Antikörper (ABIN633486) detektiert spezifisch STAU1/Staufen in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für STAU1/Staufen Antikörper (ABIN633486)

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STAU1/Staufen Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-STAU1/Staufen Antikörper

Aufreinigung: Affinity purified

Immunogen: STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STAU1 Blocking Peptide, (ABIN5616432), is also available for use as a blocking control in assays to test for specificity of this STAU1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAU1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STAU1/Staufen

Target: STAU1/Staufen (STAU1) (Staufen Double-Stranded RNA Binding Protein 1 (STAU1))

Andere Bezeichnung: STAU1

Hintergrund: This protein is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation.

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: Asymmetric Protein Localization