IGF2BP2 Antikörper (Middle Region)

Produktnummer ABIN633482

Der Kaninchen Polyklonal anti-IGF2BP2 Antikörper wird verwendet zum Nachweis von IGF2BP2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für IGF2BP2 Antikörper (Middle Region) (ABIN633482)

Target: IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGF2BP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IGF2BP2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IGF2 BP2 antibody was raised against the middle region of IGF2 P2

Aufreinigung: Affinity purified

Immunogen: IGF2 BP2 antibody was raised using the middle region of IGF2 P2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGF2BP2 Blocking Peptide, (ABIN5614154), is also available for use as a blocking control in assays to test for specificity of this IGF2BP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGF2BP2

Target: IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))

Andere Bezeichnung: IGF2BP2

Hintergrund: IGF2BP2 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs.

Molekulargewicht: 66 kDa (MW of target protein)