A2BP1 Antikörper (Middle Region)

Produktnummer ABIN633356

Der Kaninchen Polyklonal anti-A2BP1 Antikörper wird verwendet zum Nachweis von A2BP1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für A2BP1 Antikörper (Middle Region) (ABIN633356)

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A2BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-A2BP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: A2 BP1 antibody was raised against the middle region of A2 P1

Aufreinigung: Affinity purified

Immunogen: A2 BP1 antibody was raised using the middle region of A2 P1 corresponding to a region with amino acids TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A2BP1 Blocking Peptide, (ABIN5611837), is also available for use as a blocking control in assays to test for specificity of this A2BP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A2BP1

Target: A2BP1 (Ataxin 2-Binding Protein 1 (A2BP1))

Andere Bezeichnung: A2BP1

Hintergrund: Ataxin-2 binding protein 1(A2BP1) has an RNP motif that is highly conserved among RNA-binding proteins. This protein binds to the C-terminus of ataxin-2 and may contribute to the restricted pathology of spinocerebellar ataxia type 2 (SCA2).

Molekulargewicht: 42 kDa (MW of target protein)