SIP1 Antikörper (Middle Region)

Produktnummer ABIN633250

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SIP1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SIP1 Antikörper (Middle Region) (ABIN633250)

Target: SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SIP1 antibody was raised against the middle region of SIP1

Aufreinigung: Affinity purified

Immunogen: SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIP1 Blocking Peptide, (ABIN939242), is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIP1

Target: SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))

Andere Bezeichnung: SIP1

Hintergrund: Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Tube Formation