POLI Antikörper

Produktnummer ABIN633154

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch POLI in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für POLI Antikörper (ABIN633154)

Target: POLI (Polymerase (DNA Directed) iota (POLI))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLI Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POLI Antikörper

Aufreinigung: Affinity purified

Immunogen: POLI antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLI Blocking Peptide, (ABIN5615457), is also available for use as a blocking control in assays to test for specificity of this POLI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLI

Target: POLI (Polymerase (DNA Directed) iota (POLI))

Andere Bezeichnung: POLI

Hintergrund: POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.

Molekulargewicht: 83 kDa (MW of target protein)

Pathways: DNA Reparatur