FGL2 Antikörper (Middle Region)

Produktnummer ABIN633034

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch FGL2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für FGL2 Antikörper (Middle Region) (ABIN633034)

Target: FGL2 (Fibrinogen-Like 2 (FGL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FGL2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FGL2 antibody was raised against the middle region of FGL2

Aufreinigung: Affinity purified

Immunogen: FGL2 antibody was raised using the middle region of FGL2 corresponding to a region with amino acids WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FGL2 Blocking Peptide, (ABIN935985), is also available for use as a blocking control in assays to test for specificity of this FGL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FGL2

Target: FGL2 (Fibrinogen-Like 2 (FGL2))

Andere Bezeichnung: FGL2

Hintergrund: The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.

Molekulargewicht: 48 kDa (MW of target protein)