In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2) Antikörper

Antigen

Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2)
Synonyme MGC45594, ZADH2
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen
Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN633018
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung
Anwendungen Alternativen Sekundärantikörper Varianten zurück nach oben

Weitere Bezeichnung ZADH2
Immunogen ZADH2 antibody was raised using the N terminal of ZADH2 corresponding to a region with amino acids MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT
Beschreibung The function of ZADH2 has not been widely studied, and is yet to be fully elucidated.
Molekulargewicht 40 kDa (MW of target protein)

Anwendungen
Alternativen Sekundärantikörper Varianten zurück nach oben

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZADH2 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternativen
Anwendungen Sekundärantikörper Varianten zurück nach oben

Alternativen zu Antigen "Zinc Binding Alcohol Dehydrogenase Domain Containing 2 (ZADH2)", Typ "Antikörper" finden
Wirte Kaninchen (8)
Reaktivitäten Human (7), Maus (4), Ratte (Rattus) (3), Rind (Kuh) (2), Hund (2)
Applikationen Western Blot (WB) (6), ELISA (2), Dot Blot (Dot) (1), Enzyme Immunoassay (EIA) (1)
Epitope N-Term (2)