MMADHC Antikörper

Produktnummer ABIN632628

Der Kaninchen Polyklonal anti-MMADHC Antikörper (ABIN632628) detektiert spezifisch MMADHC in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MMADHC Antikörper (ABIN632628)

Target: MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MMADHC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MMADHC Antikörper

Aufreinigung: Affinity purified

Immunogen: C2 orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2orf25 Blocking Peptide, (ABIN938972), is also available for use as a blocking control in assays to test for specificity of this C2orf25 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf25 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MMADHC

Target: MMADHC (Methylmalonic Aciduria (Cobalamin Deficiency) CblD Type, with Homocystinuria (MMADHC))

Andere Bezeichnung: C2orf25

Hintergrund: Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.

Molekulargewicht: 33 kDa (MW of target protein)