In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Heat Shock 70kDa Protein 4-Like (HSPA4L) Antikörper

Antigen

Heat Shock 70kDa Protein 4-Like (HSPA4L)

Synonyme APG-1, Osp94
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN632518
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung HSPA4L
Immunogen HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Beschreibung HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Molekulargewicht 92 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA4L antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Signaltransduktion, Hitzeschockproteine
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Heat Shock 70kDa Protein 4-Like (HSPA4L)", Typ "Antikörper" finden
Wirte Kaninchen (7), Ziege (6)
Reaktivitäten Human (10), Hund (2), Huhn (1), Rind (Kuh) (1), Maus (1), Ratte (Rattus) (1)
Applikationen Western Blot (WB) (8), ELISA (5), Enzyme Immunoassay (EIA) (4), Immunhistochemie (Paraffinschnitte) (IHC (p)) (2), Durchflusszytometrie (FACS) (1), Immunhistochemie (IHC) (1)
Epitope C-Term (3)