PDXK Antikörper

Produktnummer ABIN632330

Der Kaninchen Polyklonal anti-PDXK Antikörper wird verwendet zum Nachweis von PDXK in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für PDXK Antikörper (ABIN632330)

Target: PDXK (Pyridoxal Kinase (PDXK))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDXK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDXK Antikörper

Aufreinigung: Affinity purified

Immunogen: PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDXK Blocking Peptide, (ABIN5615299), is also available for use as a blocking control in assays to test for specificity of this PDXK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDXK

Target: PDXK (Pyridoxal Kinase (PDXK))

Andere Bezeichnung: PDXK

Hintergrund: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer.

Molekulargewicht: 34 kDa (MW of target protein)