CSNK1G3 Antikörper (Middle Region)

Produktnummer ABIN632247

Der Kaninchen Polyklonal anti-CSNK1G3 Antikörper (ABIN632247) detektiert spezifisch CSNK1G3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für CSNK1G3 Antikörper (Middle Region) (ABIN632247)

Target: CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSNK1G3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CSNK1G3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CK1 gamma 3 antibody was raised against the middle region of CSNK1 G3

Aufreinigung: Affinity purified

Immunogen: CK1 gamma 3 antibody was raised using the middle region of CSNK1 G3 corresponding to a region with amino acids LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK1 gamma 3 Blocking Peptide, (ABIN940261), is also available for use as a blocking control in assays to test for specificity of this CK1 gamma 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSNK1G3

Target: CSNK1G3 (Casein Kinase 1, gamma 3 (CSNK1G3))

Andere Bezeichnung: CK1 gamma 3

Hintergrund: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1G3 can phosphorylate a large number of proteins. It participates in Wnt signaling.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Hedgehog Signalweg