14-3-3 zeta Antikörper (Middle Region)

Produktnummer ABIN632205

Der Kaninchen Polyklonal anti-14-3-3 zeta Antikörper (ABIN632205) detektiert spezifisch 14-3-3 zeta in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für 14-3-3 zeta Antikörper (Middle Region) (ABIN632205)

Target: 14-3-3 zeta (YWHAZ)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser 14-3-3 zeta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-14-3-3 zeta Antikörper

Bindungsspezifität: Middle Region

Spezifität: YWHAZ antibody was raised against the middle region of Ywhaz

Aufreinigung: Affinity purified

Immunogen: YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

YWHAZ Blocking Peptide, (ABIN938248), is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Andere Bezeichnung: YWHAZ

Hintergrund: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location