Carabin Antikörper (N-Term)

Produktnummer ABIN632187

Der Kaninchen Polyklonal anti-Carabin Antikörper (ABIN632187) detektiert spezifisch Carabin in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Carabin Antikörper (N-Term) (ABIN632187)

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Carabin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Carabin Antikörper

Bindungsspezifität: N-Term

Spezifität: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Aufreinigung: Affinity purified

Immunogen: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D10C Blocking Peptide, (ABIN5616511), is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Carabin

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Andere Bezeichnung: TBC1D10C

Hintergrund: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin that also inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein activity.

Molekulargewicht: 50 kDa (MW of target protein)