In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Secreted Frizzled-Related Protein 2 (SFRP2) Antikörper

Antigen

Secreted Frizzled-Related Protein 2 (SFRP2)

Synonyme FRP-2, SARP1, SDF-5, Sdf5, AI851596, frp-2, sarp1, sdf-5, sfrp-2, MGC53344, MGC75789, SFRP-2, MGC128911, zeh0225, MGC153618, hm:zeh0225, zgc:153618, SFRP2, sfrp2
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN632136
Menge 50 ug  (1 mg/ml)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung SFRP2
Immunogen SFRP2 antibody was raised using the middle region of SFRP2 corresponding to a region with amino acids DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN
Beschreibung SFRP2 is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. Methylation of this gene is a potential marker for the presence of colorectal cancer.
Molekulargewicht 31 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRP2 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Kardiovaskuläres System, Kardiogenese, Wnt
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Secreted Frizzled-Related Protein 2 (SFRP2)", Typ "Antikörper" finden
Wirte Kaninchen (6), Ziege (5)
Reaktivitäten Human (9), Maus (6), Ratte (Rattus) (6), Hund (5), Rind (Kuh) (1), Kaninchen (1)
Applikationen Western Blot (WB) (9), ELISA (3), Enzyme Immunoassay (EIA) (2), Immunfluoreszenz (IF) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1)
Epitope AA 281-295 (1)