PLEKHH2 Antikörper

Produktnummer ABIN632080

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PLEKHH2 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für PLEKHH2 Antikörper (ABIN632080)

Target: PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLEKHH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLEKHH2 Antikörper

Aufreinigung: Affinity purified

Immunogen: PLEKHH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLEKHH2 Blocking Peptide, (ABIN5615418), is also available for use as a blocking control in assays to test for specificity of this PLEKHH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLEKHH2

Target: PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))

Andere Bezeichnung: PLEKHH2

Hintergrund: PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a single-pass membrane protein. The exact function of PLEKHH2 remains unknown.

Molekulargewicht: 168 kDa (MW of target protein)