Carabin Antikörper (N-Term)

Produktnummer ABIN632014

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Carabin in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für Carabin Antikörper (N-Term) (ABIN632014)

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Carabin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Carabin Antikörper

Bindungsspezifität: N-Term

Spezifität: TBC1 D11 antibody was raised against the N terminal of TBC1 11

Aufreinigung: Affinity purified

Immunogen: TBC1 D11 antibody was raised using the N terminal of TBC1 11 corresponding to a region with amino acids MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBC1D10C Blocking Peptide, (ABIN5616512), is also available for use as a blocking control in assays to test for specificity of this TBC1D10C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Carabin

Target: Carabin (TBC1D10C) (TBC1 Domain Family, Member 10C (TBC1D10C))

Andere Bezeichnung: TBC1D10C

Hintergrund: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.

Molekulargewicht: 50 kDa (MW of target protein)