CAD Antikörper (Middle Region)

Produktnummer ABIN631789

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CAD in WB. Es zeigt Reaktivität gegenüber Proben von Drosophila melanogaster.

Kurzübersicht für CAD Antikörper (Middle Region) (ABIN631789)

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CAD Antikörper

Bindungsspezifität: Middle Region

Spezifität: CAD antibody was raised against the middle region of CAD

Aufreinigung: Affinity purified

Immunogen: CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAD Blocking Peptide, (ABIN5612572), is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAD

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Andere Bezeichnung: CAD

Hintergrund: Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process