HACE1 Antikörper (Middle Region)

Produktnummer ABIN631377

Der Kaninchen Polyklonal anti-HACE1 Antikörper (ABIN631377) detektiert spezifisch HACE1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für HACE1 Antikörper (Middle Region) (ABIN631377)

Target: HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HACE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HACE1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HACE1 antibody was raised against the middle region of HACE1

Aufreinigung: Affinity purified

Immunogen: HACE1 antibody was raised using the middle region of HACE1 corresponding to a region with amino acids DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HACE1 Blocking Peptide, (ABIN937609), is also available for use as a blocking control in assays to test for specificity of this HACE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HACE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HACE1

Target: HACE1 (HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1))

Andere Bezeichnung: HACE1

Hintergrund: HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.

Molekulargewicht: 102 kDa (MW of target protein)