In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

WAS Protein Family, Member 3 (WASF3) Antikörper

Antigen

WAS Protein Family, Member 3 (WASF3)

Synonyme SCAR3, WAVE3, Brush-1, KIAA0900
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN631248
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung WASF3
Immunogen WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
Beschreibung WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.
Molekulargewicht 55 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WASF3 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "WAS Protein Family, Member 3 (WASF3)", Typ "Antikörper" finden
Wirte Kaninchen (30), Maus (2)
Reaktivitäten Human (31), Maus (21), Rind (Kuh) (18), Ratte (Rattus) (18), Schwein (15), Kaninchen (15), Huhn (3), Hund (3)
Applikationen Durchflusszytometrie (FACS) (18), Immunfluoreszenz (IF) (18), Western Blot (WB) (10), ELISA (7), ELISA (Detektionsantikörper) (3), Immunpräzipitation (IP) (3), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunhistochemie (Paraffinschnitte) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunhistochemie (IHC) (1)
Konjugate Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)