ATP6V1B2 Antikörper (Middle Region)

Produktnummer ABIN631234

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ATP6V1B2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für ATP6V1B2 Antikörper (Middle Region) (ABIN631234)

Target: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V1B2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATP6V1B2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ATP6 V6 2 antibody was raised against the middle region of ATP6 6 2

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 2 antibody was raised using the middle region of ATP6 6 2 corresponding to a region with amino acids NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V1B2 Blocking Peptide, (ABIN5612235), is also available for use as a blocking control in assays to test for specificity of this ATP6V1B2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V1B2

Target: ATP6V1B2 (ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2))

Andere Bezeichnung: ATP6V1B2

Hintergrund: ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport