Heat Shock 22kDa Protein 8 (HSPB8) Antikörper

Antigen: Heat Shock 22kDa Protein 8 (HSPB8)

Synonyme: H11, HMN2, CMT2L, DHMN2, E2IG1, HMN2A, HSP22, MGC64408, HSPB8, DKFZp468F234, fc09c11, MGC64202, zgc:64202, wu:fc04b04, wu:fc09c11

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630901

Produktbeschreibung

Weitere Bezeichnung: HSPB8

Immunogen: HSPB8 antibody was raised using the N terminal of HSPB8 corresponding to a region with amino acids ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW

Beschreibung: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Molekulargewicht: 21 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPB8 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar