FANCE Antikörper (Middle Region)

Produktnummer ABIN630869

Der Kaninchen Polyklonal anti-FANCE Antikörper wird verwendet zum Nachweis von FANCE in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für FANCE Antikörper (Middle Region) (ABIN630869)

Target: FANCE (Fanconi Anemia, Complementation Group E (FANCE))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FANCE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FANCE Antikörper

Bindungsspezifität: AA 1-13, Middle Region

Spezifität: FANCE antibody was raised against the middle region of FANCE

Aufreinigung: Affinity purified

Immunogen: FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FANCE Blocking Peptide, (ABIN5613515), is also available for use as a blocking control in assays to test for specificity of this FANCE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FANCE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FANCE

Target: FANCE (Fanconi Anemia, Complementation Group E (FANCE))

Andere Bezeichnung: FANCE

Hintergrund: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: DNA Reparatur