In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

STIP1 Homology and U-Box Containing Protein 1 (STUB1) Antikörper

Antigen

STIP1 Homology and U-Box Containing Protein 1 (STUB1)

Synonyme CHIP, UBOX1, HSPABP2, NY-CO-7, SDCCAG7, Chip, AW046544, 0610033N24Rik, 2210017D18Rik, 2310040B03Rik, MGC116422, zgc:56076, wu:fc22f04, STUB1, chip, MGC146414
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN630820
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung STUB1
Immunogen STUB1 antibody was raised using the N terminal of STUB1 corresponding to a region with amino acids MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYG
Beschreibung STUB1 modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It has E3 ubiquitin-protein ligase activity and targets misfolded chaperone substrates towards proteasomal degradation. STUB1 mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation.
Molekulargewicht 35 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of STUB1 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Chromatin und nukleäre Signaltransduktion, Zellzyklus, Hitzeschockproteine
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "STIP1 Homology and U-Box Containing Protein 1 (STUB1)", Typ "Antikörper" finden
Wirte Kaninchen (20), Ziege (5), Maus (2), Huhn (1)
Reaktivitäten Human (25), Maus (9), Rind (Kuh) (3), Ratte (Rattus) (3), Huhn (2), Fruchtfliege (Drosophila melanogaster) (1), Affe (1)
Applikationen Western Blot (WB) (26), Enzyme Immunoassay (EIA) (7), Immunhistochemie (Paraffinschnitte) (IHC (p)) (6), Immunpräzipitation (IP) (5), ELISA (4), Immunhistochemie (IHC) (3), Immunzytochemie (ICC) (2), Dot Blot (Dot) (1), ELISA (Detektionsantikörper) (1), Immunfluoreszenz (IF) (1)