CAD Antikörper (N-Term)

Produktnummer ABIN630621

Der Kaninchen Polyklonal anti-CAD Antikörper (ABIN630621) detektiert spezifisch CAD in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für CAD Antikörper (N-Term) (ABIN630621)

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CAD Antikörper

Bindungsspezifität: N-Term

Spezifität: CAD antibody was raised against the N terminal of CAD

Aufreinigung: Affinity purified

Immunogen: CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAD Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAD

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Andere Bezeichnung: CAD

Hintergrund: CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.

Molekulargewicht: 243 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process