Cystathionase (Cystathionine gamma-Lyase) (CTH) Antikörper

Antigen: Cystathionase (Cystathionine gamma-Lyase) (CTH)

Synonyme: CTH, DKFZp469D0332, zgc:66001, zgc:85785, wu:fb48e03, wu:fb58d08, Cys3, AI314617, BC019483, MGC28655, 0610010I13Rik, MGC9471, cysA, SCQ11.03c, H, MGC75946

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN630555

Produktbeschreibung

Weitere Bezeichnung: Cystathionase

Immunogen: Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF

Beschreibung: CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.

Molekulargewicht: 44 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CTH antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Metabolismus, Aminosäuren

Beschränkungen: Nur für Forschungszwecke einsetzbar