SLC6A8 Antikörper

Produktnummer ABIN630409

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC6A8 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte und Hund.

Kurzübersicht für SLC6A8 Antikörper (ABIN630409)

Target: SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC6A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC6A8 Antikörper

Aufreinigung: Purified

Immunogen: SLC6 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A8 Blocking Peptide, (ABIN937056), is also available for use as a blocking control in assays to test for specificity of this SLC6A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC6A8

Target: SLC6A8 (Solute Carrier Family 6 (Neurotransmitter Transporter, Creatine), Member 8 (SLC6A8))

Andere Bezeichnung: SLC6A8

Hintergrund: SLC6A8 is required for the uptake of creatine in muscles and brain.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding, ER-Nucleus Signaling, Unfolded Protein Response