SLC22A1 Antikörper

Produktnummer ABIN630301

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC22A1 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC22A1 Antikörper (ABIN630301)

Target: SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC22A1 Antikörper

Aufreinigung: Purified

Immunogen: SLC22 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A1 Blocking Peptide, (ABIN939278), is also available for use as a blocking control in assays to test for specificity of this SLC22A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A1

Target: SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))

Andere Bezeichnung: SLC22A1

Hintergrund: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: Hormone Transport