KCNN2 Antikörper (C-Term)

Produktnummer ABIN630068

Der Kaninchen Polyklonal anti-KCNN2 Antikörper wird verwendet zum Nachweis von KCNN2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für KCNN2 Antikörper (C-Term) (ABIN630068)

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNN2 Antikörper

Bindungsspezifität: C-Term

Spezifität: KCNN2 antibody was raised against the C terminal of KCNN2

Aufreinigung: Purified

Immunogen: KCNN2 antibody was raised using the C terminal of KCNN2 corresponding to a region with amino acids IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNN2 Blocking Peptide, (ABIN939300), is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNN2

Target: KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))

Andere Bezeichnung: KCNN2

Hintergrund: Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.

Molekulargewicht: 64 kDa (MW of target protein)