HFM1 Antikörper

Produktnummer ABIN629932

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HFM1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für HFM1 Antikörper (ABIN629932)

Target: HFM1 (HFM1, ATP-Dependent DNA Helicase Homolog (HFM1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HFM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HFM1 Antikörper

Aufreinigung: Purified

Immunogen: Helicase antibody was raised using a synthetic peptide corresponding to a region with amino acids FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Helicase Blocking Peptide, (ABIN938299), is also available for use as a blocking control in assays to test for specificity of this Helicase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HFM1

Target: HFM1 (HFM1, ATP-Dependent DNA Helicase Homolog (HFM1))

Andere Bezeichnung: Helicase

Hintergrund: The protein encoded by this gene is a DNA helicase. A dominant-negative mutant of this protein blocks chromosomal DNA replication and suggests that its function is required for S phase entry.

Molekulargewicht: 120 kDa (MW of target protein)