ACP1 Antikörper (N-Term)

Produktnummer ABIN629849

Der Kaninchen Polyklonal anti-ACP1 Antikörper wird verwendet zum Nachweis von ACP1 in Proben von Human. Er wurde validiert für WB und IHC.

Kurzübersicht für ACP1 Antikörper (N-Term) (ABIN629849)

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ACP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACP1 antibody was raised against the N terminal of ACP1

Aufreinigung: Purified

Immunogen: ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP1 Blocking Peptide, (ABIN5611911), is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP1

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Andere Bezeichnung: ACP1

Hintergrund: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate.

Molekulargewicht: 17 kDa (MW of target protein)