In den Warenkorb
Bestellen Sie auch über:
 |
+49 (0)241 95 163 153 |
 |
+49 (0)241 95 163 155 |
LIM Domain Binding 3 (LDB3) Antikörper
| Antigen | LIM Domain Binding 3 (LDB3) |
| Synonyme | ZASP, CYPHER, ORACLE, PDLIM6, ldb3z1, ldb3z4, FLJ35865, KIAA0613, KIAA01613, AW742271, MGC118603, ldb3l, zgc:55814, wu:fi31d08, ldb3, MGC52706, MGC75668, LDB3, RGD1564875 |
| Klonalität | Polyklonal |
| Wirt |
 Alternativen Kaninchen |
| Applikation |
Alternativen Western Blot (WB)
|
| Produktnummer | ABIN629714 |
| Menge | 100 ug (1 mg/ml) |
| Preis | 376,65 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 5 bis 7 Werktagen |
Produktbeschreibung
| Weitere Bezeichnung | LDB3 |
| Immunogen | LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS |
| Beschreibung | LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton. |
| Molekulargewicht | 36 kDa (MW of target protein) |
Anwendungen
| Konzentration | 1 mg/ml |
| Reinigung | Total IgG Protein A purified |
| Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LDB3 antibody in PBS |
| Lagerung | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Forschungsgebiet | Signaltransduktion |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
Alternativen
Alternativen zu Antigen "LIM Domain Binding 3 (LDB3)", Typ "Antikörper" finden
| Wirte | Maus (6), Ziege (5), Kaninchen (5) |
| Reaktivitäten | Human (14), Hund (2), Maus (2), Ratte (Rattus) (2), Rind (Kuh) (1) |
| Applikationen | Western Blot (WB) (15), Enzyme Immunoassay (EIA) (5), ELISA (3), Immunfluoreszenz (IF) (2), ELISA (Detektionsantikörper) (1), Immunhistochemie (Paraffinschnitte) (IHC (p)) (1) |
