WD Repeat Domain 13 (WDR13) Antikörper

Antigen: WD Repeat Domain 13 (WDR13)

Synonyme: MG21, FLJ20563, DKFZp779C2057, mMg21, W51679, MGC117822, MGC158990, DXHXS7467e, 1700060B08Rik, 5730411P10Rik, RGD1560982, MGC80988, WDR13, MGC79608, MGC138915, DKFZp469E2032

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN629704

Produktbeschreibung

Weitere Bezeichnung: WDR13

Immunogen: WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV

Beschreibung: WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.

Molekulargewicht: 53 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of WDR13 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Beschränkungen: Nur für Forschungszwecke einsetzbar