Defensin, beta 4A (DEFB4) (AA 4-41) Antikörper

Antigen: Defensin, beta 4A (DEFB4)

Synonyme: SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2

Epitope: AA 4-41

Klonalität: Monoklonal (L12-4C-C2)

Wirt: Maus

Reaktivität: Human

Applikation: ELISA

Produktnummer: ABIN234970

Produktbeschreibung

Weitere Bezeichnung: Human beta-Defensin-2 (amino acids 4-41)

Immunogen: Synthetic human beta-Defensin 2 (a.a. 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)

Format: Purified, Lyophilized

Isotyp: IgG1  (Passende Sekundärantikörper)

Klon: L12-4C-C2

Beschreibung: MAb to beta-Defensin-2 (a.a. 4-41) Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41) Cell culture supernatant

Spezifität: Synthetic human beta-Defensin 2 (a.a. 4-41)

Synonyme: SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2

Anwendungen

Applikationshinweise: Suitable for use in ELISA. Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.

Konzentration: 1mg/ml (prior to lyophilization)

Reinigung: Protein L chromatography. Source: Cell culture supernatant

Buffer: Lyophilized from 50mM Tris, pH 7.4.

Lagerung: Store lyophilized product at 2-8°C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.Reconstitute in 10ul double distilled water.

Beschränkungen: Nur für Forschungszwecke einsetzbar